1.50 a resolution structure of the c-terminally truncated [2fe-2s] ferredoxin (bfd) r26e mutant from pseudomonas aeruginosa
PDB DOI: 10.2210/pdb6e6r/pdb
Classification: ELECTRON TRANSPORT Organism(s): Pseudomonas Aeruginosa
Deposited: 2018-07-25 Deposition Author(s): Battaile, K.P. , Lovell, S. , Rivera, M. , Wang, Y. , Wijerathne, H. , Yao, H.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
1.50 a resolution structure of the c-terminally truncated [2fe-2s] ferredoxin (bfd) r26e mutant from pseudomonas aeruginosa
Battaile, K.P. , Lovell, S. , Rivera, M. , Wang, Y. , Wijerathne, H. , Yao, H.
Primary Citation of Related Structures: 6E6R
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bacterioferritin-associated ferredoxin | A | 56 | Pseudomonas Aeruginosa | MYVCLCQGVTDNQIRDAIYEGCCSYEEVREATGVGTQCGKCASLAKQVVRETLNDL |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-25 Deposition Author(s): Battaile, K.P. , Lovell, S. , Rivera, M. , Wang, Y. , Wijerathne, H. , Yao, H.