Structure of the t. brucei rrm domain in complex with rna
PDB DOI: 10.2210/pdb6e4p/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Trypanosoma Brucei , Synthetic Construct
Deposited: 2018-07-18 Deposition Author(s): Schumacher, M.A.
Method: X-RAY DIFFRACTION Resolution: 1.949 Å
Structure of the t. brucei rrm domain in complex with rna
Primary Citation of Related Structures: 6E4P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA-binding protein, putative | A | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | B | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | C | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | D | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | E | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | F | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | G | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | H | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
| RNA-binding protein, putative | I | 71 | Trypanosoma Brucei , Synthetic Construct | GSHMRVQVSGLSDETTWHTLKDHLRQAGEVTFCKVFSGGRAVVEFVTPEDAARAITELQASELEGATLFLR |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-18 Deposition Author(s): Schumacher, M.A.