Crystal structure of pho7-dna complex
PDB DOI: 10.2210/pdb6e33/pdb
Classification: TRANSCRIPTION Organism(s): Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) , Synthetic Construct
Deposited: 2018-07-13 Deposition Author(s): Garg, A. , Goldgur, Y. , Shuman, S.
Crystal structure of pho7-dna complex
Garg, A. , Goldgur, Y. , Shuman, S.
Primary Citation of Related Structures: 6E33
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Uncharacterized transcriptional regulatory protein C27B12.11c | A | 61 | Schizosaccharomyces Pombe (Strain 972 / Atcc 24843) , Synthetic Construct | GKVKKRLPQAKRACAKCQKDNKKCDDARPCQRCIKAKTDCIDLPRKKRPTGVRRGPYKKLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-07-13 Deposition Author(s): Garg, A. , Goldgur, Y. , Shuman, S.