Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: reaction in 2 mm mg2+ and 25 mm k+ for 120 s at 21 c (dataset 1)
PDB DOI: 10.2210/pdb6dok/pdb
Classification: HYDROLASE/DNA/RNA Organism(s): Bacillus Halodurans , Synthetic Construct
Deposited: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.
Crystal structure of bacillus halodurans ribonuclease h1 in complex with an rna/dna hybrid: reaction in 2 mm mg2+ and 25 mm k+ for 120 s at 21 c (dataset 1)
Primary Citation of Related Structures: 6DOK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease H | A | 135 | Bacillus Halodurans , Synthetic Construct | EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGR |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-09 Deposition Author(s): Samara, N.L. , Yang, W.