Remodeled crystal structure of dna-bound dux4-hd2
PDB DOI: 10.2210/pdb6dfy/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Fremyella Diplosiphon
Deposited: 2018-05-15 Deposition Author(s): Aihara, H. , Shi, K.
Remodeled crystal structure of dna-bound dux4-hd2
Primary Citation of Related Structures: 6DFY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Double homeobox protein 4 | C | 64 | Salmonella Enterica , Fremyella Diplosiphon | GSHMGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHPGQG |
Double homeobox protein 4 | D | 64 | Salmonella Enterica , Fremyella Diplosiphon | GSHMGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHPGQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-15 Deposition Author(s): Aihara, H. , Shi, K.