Remodeled crystal structure of dna-bound dux4-hd2
PDB DOI: 10.2210/pdb6dfy/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-05-15 Deposition Author(s): Aihara, H. , Shi, K.
Method: X-RAY DIFFRACTION Resolution: 2.623 Å
Remodeled crystal structure of dna-bound dux4-hd2
Primary Citation of Related Structures: 6DFY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Double homeobox protein 4 | C | 64 | Homo Sapiens , Synthetic Construct | GSHMGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHPGQG |
| Double homeobox protein 4 | D | 64 | Homo Sapiens , Synthetic Construct | GSHMGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHPGQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-15 Deposition Author(s): Aihara, H. , Shi, K.