Crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1 (cbx1) with h3k9bn peptide
PDB DOI: 10.2210/pdb6d08/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-04-10 Deposition Author(s): Arora, S. , Horne, W.S. , Islam, K.
Crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1 (cbx1) with h3k9bn peptide
Arora, S. , Horne, W.S. , Islam, K.
Primary Citation of Related Structures: 6D08
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 1 | A | 55 | Homo Sapiens , Synthetic Construct | GEFVVEKVLDRRVVKGKVEYLLKWKGGSDEDNTWEPEENLDCPDLIAEFLQSQKT |
| Chromobox protein homolog 1 | B | 55 | Homo Sapiens , Synthetic Construct | GEFVVEKVLDRRVVKGKVEYLLKWKGGSDEDNTWEPEENLDCPDLIAEFLQSQKT |
| Histone H3.1 | C | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARXSTGGKAX |
| Histone H3.1 | D | 16 | Homo Sapiens , Synthetic Construct | ARTKQTARXSTGGKAX |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-04-10 Deposition Author(s): Arora, S. , Horne, W.S. , Islam, K.