Solution structure of sh3 domain from shank3
PDB DOI: 10.2210/pdb6cpk/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2018-03-13 Deposition Author(s): Ishida, H. , Vogel, H.J.
Solution structure of sh3 domain from shank3
Primary Citation of Related Structures: 6CPK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 and multiple ankyrin repeat domains protein 3 | A | 61 | Homo Sapiens | MVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQM |
Method: SOLUTION NMR
Deposited Date: 2018-03-13 Deposition Author(s): Ishida, H. , Vogel, H.J.