Solution structure of sh3 domain from shank2
PDB DOI: 10.2210/pdb6cpj/pdb
Classification: PROTEIN BINDING Organism(s): Rattus Norvegicus
Deposited: 2018-03-13 Deposition Author(s): Ishida, H. , Vogel, H.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of sh3 domain from shank2
Primary Citation of Related Structures: 6CPJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SH3 and multiple ankyrin repeat domains protein 2 | A | 61 | Rattus Norvegicus | MVPGRLFVAIKPYQPQVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQS |
Method: SOLUTION NMR
Deposited Date: 2018-03-13 Deposition Author(s): Ishida, H. , Vogel, H.J.