6CNQ
Mbd2 in complex with methylated dna
PDB DOI: 10.2210/pdb6cnq/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-03-08 Deposition Author(s): Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Xu, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.151 Å
Mbd2 in complex with methylated dna
Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Xu, C.
Primary Citation of Related Structures: 6CNQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain protein 2 | A | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK |
| Methyl-CpG-binding domain protein 2 | B | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQK |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*GP*CP*CP*AP*AP*(5CM)P*GP*TP*TP*GP*GP*C)-3') | d | 12 | NA | GCCAACGTTGGC |
| DNA (5'-D(*GP*CP*CP*AP*AP*(5CM)P*GP*TP*TP*GP*GP*C)-3') | c | 12 | NA | GCCAACGTTGGC |
| DNA (5'-D(*GP*CP*CP*AP*AP*(5CM)P*GP*TP*TP*GP*GP*C)-3') | e | 12 | NA | GCCAACGTTGGC |
| DNA (5'-D(*GP*CP*CP*AP*AP*(5CM)P*GP*TP*TP*GP*GP*C)-3') | f | 12 | NA | GCCAACGTTGGC |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-03-08 Deposition Author(s): Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Xu, C.