Structure of a new shkt peptide from the sea anemone oulactis sp: osptx2a-p2
PDB DOI: 10.2210/pdb6ckf/pdb
Classification: TOXIN Organism(s): Rhodococcus Erythropolis
Deposited: 2018-02-28 Deposition Author(s): Krishnarjuna, B. , Norton, R.S. , Sunanda, P.
Structure of a new shkt peptide from the sea anemone oulactis sp: osptx2a-p2
Krishnarjuna, B. , Norton, R.S. , Sunanda, P.
Primary Citation of Related Structures: 6CKF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
OspTx2a-p2 | A | 36 | Rhodococcus Erythropolis | ACKDVFPAATCRHAKSVGNCSSEKYKRNCAITCGAC |
Method: SOLUTION NMR
Deposited Date: 2018-02-28 Deposition Author(s): Krishnarjuna, B. , Norton, R.S. , Sunanda, P.