Nmr structure of sodium/calcium exchanger 1 (ncx1) two-helix bundle (thb) domain
PDB DOI: 10.2210/pdb6bv7/pdb
Classification: MEMBRANE PROTEIN Organism(s): Canis Lupus Familiaris
Deposited: 2017-12-12 Deposition Author(s): Bruschweiler, R. , Yuan, C. , Yuan, J.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of sodium/calcium exchanger 1 (ncx1) two-helix bundle (thb) domain
Bruschweiler, R. , Yuan, C. , Yuan, J.
Primary Citation of Related Structures: 6BV7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sodium/calcium exchanger 1 | A | 57 | Canis Lupus Familiaris | SNAVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRA |
Method: SOLUTION NMR
Deposited Date: 2017-12-12 Deposition Author(s): Bruschweiler, R. , Yuan, C. , Yuan, J.