Glucocorticoid receptor bound to high cooperativity monomer sequence
PDB DOI: 10.2210/pdb6bse/pdb
Classification: GENE REGULATION Organism(s): Pseudomonas Fluorescens A506 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-12-02 Deposition Author(s): Pufall, M.A.
Glucocorticoid receptor bound to high cooperativity monomer sequence
Primary Citation of Related Structures: 6BSE
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Glucocorticoid receptor | A | 91 | Pseudomonas Fluorescens A506 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATT |
Glucocorticoid receptor | B | 91 | Pseudomonas Fluorescens A506 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATT |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-02 Deposition Author(s): Pufall, M.A.