Hiv-1 immature ctd-sp1 hexamer in complex with ip6
PDB DOI: 10.2210/pdb6bhr/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Bh10)
Deposited: 2017-10-31 Deposition Author(s): Ganser-Pornillos, B.K. , Pornillos, O. , Wagner, J.M. , Zadrozny, K.
Method: X-RAY DIFFRACTION Resolution: 2.908 Å
Hiv-1 immature ctd-sp1 hexamer in complex with ip6
Ganser-Pornillos, B.K. , Pornillos, O. , Wagner, J.M. , Zadrozny, K.
Primary Citation of Related Structures: 6BHR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Capsid protein p24,Spacer peptide 1 | G | 95 | Human Immunodeficiency Virus Type 1 Group M Subtype B (Isolate Bh10) | SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTN |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-10-31 Deposition Author(s): Ganser-Pornillos, B.K. , Pornillos, O. , Wagner, J.M. , Zadrozny, K.