Crystal structure of the c-terminal domain of doublecortin (tgdcx) from toxoplasma gondii me49
PDB DOI: 10.2210/pdb6b4a/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Toxoplasma Gondii
Deposited: 2017-09-26 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of the c-terminal domain of doublecortin (tgdcx) from toxoplasma gondii me49
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 6B4A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Doublecortin | A | 104 | Toxoplasma Gondii | MAHHHHHHIPAPRLMWLYRNGDKHDDGTPFFVRPYIKSMESLYQQITKEITPIAGPVRRIFDQNFRVITDLDDIVDGAKYLCTSGEPPAAYDRLEKFLSEWVIQ |
| Doublecortin | B | 104 | Toxoplasma Gondii | MAHHHHHHIPAPRLMWLYRNGDKHDDGTPFFVRPYIKSMESLYQQITKEITPIAGPVRRIFDQNFRVITDLDDIVDGAKYLCTSGEPPAAYDRLEKFLSEWVIQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-09-26 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)