Solution structure of hiv-1 gp41 transmembrane domain in bicelles
PDB DOI: 10.2210/pdb6b3u/pdb
Classification: MEMBRANE PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2017-09-24 Deposition Author(s): Baber, J.L. , Bax, A. , Chiliveri, S.C. , Ghirlando, R. , Louis, J.M.
Solution structure of hiv-1 gp41 transmembrane domain in bicelles
Baber, J.L. , Bax, A. , Chiliveri, S.C. , Ghirlando, R. , Louis, J.M.
Primary Citation of Related Structures: 6B3U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 GP41 Transmembrane Domain | A | 40 | Human Immunodeficiency Virus 1 | NWLWYIRIFIIIVGSLIGLRIVFAVLSLVNRVRQGYSPLS |
Method: SOLUTION NMR
Deposited Date: 2017-09-24 Deposition Author(s): Baber, J.L. , Bax, A. , Chiliveri, S.C. , Ghirlando, R. , Louis, J.M.