Exploring cystine dense peptide space to open a unique molecular toolbox
PDB DOI: 10.2210/pdb6avd/pdb
Classification: TOXIN Organism(s): Opistophthalmus Carinatus
Deposited: 2017-09-01 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Exploring cystine dense peptide space to open a unique molecular toolbox
Gewe, M.M. , Rupert, P. , Strong, R.K.
Primary Citation of Related Structures: 6AVD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 6.9 | A | 40 | Opistophthalmus Carinatus | GSAEIIRCSGTRECYAPCQKLTGCLNAKCMNKACKCYGCV |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-09-01 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.