Exploring cystine dense peptide space to open a unique molecular toolbox
PDB DOI: 10.2210/pdb6aty/pdb
Classification: TOXIN Organism(s): Lychas Mucronatus
Deposited: 2017-08-29 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Exploring cystine dense peptide space to open a unique molecular toolbox
Gewe, M.M. , Rupert, P. , Strong, R.K.
Primary Citation of Related Structures: 6ATY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Venom protein 51.1 | A | 39 | Lychas Mucronatus | GSISIGIKCSPSIDLCEGQCRIRKYFTGYCSGDTCHCSG |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-29 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.