Exploring cystine dense peptide space to open a unique molecular toolbox
PDB DOI: 10.2210/pdb6atw/pdb
Classification: TOXIN Organism(s): Leiurus Quinquestriatus Quinquestriatus
Deposited: 2017-08-29 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.
Exploring cystine dense peptide space to open a unique molecular toolbox
Gewe, M.M. , Rupert, P. , Strong, R.K.
Primary Citation of Related Structures: 6ATW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chlorotoxin | A | 38 | Leiurus Quinquestriatus Quinquestriatus | GSMCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-29 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.