PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6ATV

The molecular mechanisms by which ns1 of the 1918 spanish influenza a virus hijack host protein-protein interactions

PDB DOI: 10.2210/pdb6atv/pdb

Classification: protein binding/viral protein
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2017-08-29
Deposition Author(s): Cho, J.H. , Li, P. , Shen, Q. , Zeng, D. , Zhao, B.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.751 Å

6atv
Literature

The molecular mechanisms by which ns1 of the 1918 spanish influenza a virus hijack host protein-protein interactions

Cho, J.H. , Li, P. , Shen, Q. , Zeng, D. , Zhao, B.

Primary Citation of Related Structures: 6ATV


Proteins
Molecule Chains Sequence Length Organism Sequence
Adapter molecule crk A 58 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR
proline-rich motif in IAV-NS1 M 15 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XYGRPPLPPKQKRKX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2017-08-29
Deposition Author(s): Cho, J.H. , Li, P. , Shen, Q. , Zeng, D. , Zhao, B.