The molecular mechanisms by which ns1 of the 1918 spanish influenza a virus hijack host protein-protein interactions
PDB DOI: 10.2210/pdb6atv/pdb
Classification: protein binding/viral protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-08-29 Deposition Author(s): Cho, J.H. , Li, P. , Shen, Q. , Zeng, D. , Zhao, B.
Method: X-RAY DIFFRACTION Resolution: 1.751 Å
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Adapter molecule crk | A | 58 | Homo Sapiens , Synthetic Construct | AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR |
proline-rich motif in IAV-NS1 | M | 15 | Homo Sapiens , Synthetic Construct | XYGRPPLPPKQKRKX |
Method: X-RAY DIFFRACTION