Exploring cystine dense peptide space to open a unique molecular toolbox
PDB DOI: 10.2210/pdb6atl/pdb
Classification: TOXIN Organism(s): Tityus Serrulatus
Deposited: 2017-08-29 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.
Exploring cystine dense peptide space to open a unique molecular toolbox
Gewe, M.M. , Rupert, P. , Strong, R.K.
Primary Citation of Related Structures: 6ATL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 4.2 | A | 37 | Tityus Serrulatus | GSVVIGQRCYRSPDCYSACKKLVGKATGKCTNGRCDC |
| Potassium channel toxin alpha-KTx 4.2 | C | 37 | Tityus Serrulatus | GSVVIGQRCYRSPDCYSACKKLVGKATGKCTNGRCDC |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-29 Deposition Author(s): Gewe, M.M. , Rupert, P. , Strong, R.K.