Zinc finger region of human tet1 in complex with cpg dna
PDB DOI: 10.2210/pdb6asd/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-08-24 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.
Zinc finger region of human tet1 in complex with cpg dna
Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.
Primary Citation of Related Structures: 6ASD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methylcytosine dioxygenase TET1 | C | 47 | Homo Sapiens , Synthetic Construct | GKRKRCGVCEPCQQKTNCGECTYCKNRKNSHQICKKRKCEELKKKPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-24 Deposition Author(s): Arrowsmith, C.H. , Bountra, C. , Edwards, A.M. , Liu, K. , Min, J. , Structural Genomics Consortium (Sgc) , Tempel, W. , Walker, J.R. , Xu, C.