H, 13c, and 15n chemical shift assignments and structure of thioredoxin from mycobacterium thermoresistibile atcc 19527 and nctc 10409
PDB DOI: 10.2210/pdb6ap5/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Mycobacterium Thermoresistibile (Strain Atcc 19527 / Dsm 44167 / Cip 105390 / Jcm 6362 / Nctc 10409 / 316)
Deposited: 2017-08-17 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Tang, C.T. , Varani, G.V. , Yang, F.Y.
H, 13c, and 15n chemical shift assignments and structure of thioredoxin from mycobacterium thermoresistibile atcc 19527 and nctc 10409
Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Tang, C.T. , Varani, G.V. , Yang, F.Y.
Primary Citation of Related Structures: 6AP5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin | A | 115 | Mycobacterium Thermoresistibile (Strain Atcc 19527 / Dsm 44167 / Cip 105390 / Jcm 6362 / Nctc 10409 / 316) | MAHHHHHHMSGTVTVTDSTFKTDVLDSDTPVLVDFWADWCGPCKMVAPVLEEIANEKSGTLKVAKLDVDANPEAARDFQVVSIPTMILFKGGTPVKRIVGAKGKAALLREIEDAL |
Method: SOLUTION NMR
Deposited Date: 2017-08-17 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Tang, C.T. , Varani, G.V. , Yang, F.Y.