Structure of streptomyces venezuelae bldc-whii opt complex
PDB DOI: 10.2210/pdb6amk/pdb
Classification: dna binding protein/dna Organism(s): Streptomyces Venezuelae , Synthetic Construct
Deposited: 2017-08-09 Deposition Author(s): Schumacher, M.A.
Structure of streptomyces venezuelae bldc-whii opt complex
Primary Citation of Related Structures: 6AMK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative DNA-binding protein | A | 72 | Streptomyces Venezuelae , Synthetic Construct | GSHMTARTPDAEPPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTMGGHRRYREAEVRALMAGIPQQRSEA |
Putative DNA-binding protein | B | 72 | Streptomyces Venezuelae , Synthetic Construct | GSHMTARTPDAEPPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTMGGHRRYREAEVRALMAGIPQQRSEA |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-09 Deposition Author(s): Schumacher, M.A.