The pdz tandem fragment of a. aeolicus s2p homolog with the pa12 tag inserted between the residues 263 and 267
PDB DOI: 10.2210/pdb6akq/pdb
Classification: SIGNALING PROTEIN Organism(s): Aquifex Aeolicus Vf5
Deposited: 2018-09-03 Deposition Author(s): Kaneko, M.K. , Kato, Y. , Nogi, T. , Oi, R. , Tamura, R.
The pdz tandem fragment of a. aeolicus s2p homolog with the pa12 tag inserted between the residues 263 and 267
Kaneko, M.K. , Kato, Y. , Nogi, T. , Oi, R. , Tamura, R.
Primary Citation of Related Structures: 6AKQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PDZ tandem fragment of A. aeolicus site-2 protease homolog with the PA tag insertion | A | 189 | Aquifex Aeolicus Vf5 | GSEVPKYLKEPVVVGYVQRDSIAQKIGIKPGDKIIKINGYEVRTWEDLRDALIRLSLDGVKETTLFLERNGEVLHLTIKVPNVQKGEELGIAPLVKPVVGGVKKGSPADQVGIKPGDLILEVNGKKINTWYELVEEVRKSQGKAIKLKILRGVAMPGAEDDVVMIEKELIPAKDPKTGTYFIGLFPKTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-03 Deposition Author(s): Kaneko, M.K. , Kato, Y. , Nogi, T. , Oi, R. , Tamura, R.