Crystal structure of striatin3 in complex with sike1 coiled-coil domain
PDB DOI: 10.2210/pdb6akl/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2018-09-02 Deposition Author(s): Chen, M. , Zhou, L. , Zhou, Z.C.
Crystal structure of striatin3 in complex with sike1 coiled-coil domain
Chen, M. , Zhou, L. , Zhou, Z.C.
Primary Citation of Related Structures: 6AKL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Suppressor of IKBKE 1 | A | 54 | Homo Sapiens , Synthetic Construct | STMALLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKA |
| Suppressor of IKBKE 1 | B | 54 | Homo Sapiens , Synthetic Construct | STMALLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKA |
| Striatin-3 | C | 26 | Homo Sapiens , Synthetic Construct | PQNSQLTWKQGRQLLRQYLQEVGYTD |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-02 Deposition Author(s): Chen, M. , Zhou, L. , Zhou, Z.C.