Structure of histone demethylase ref6 complexed with dna
PDB DOI: 10.2210/pdb6a57/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-06-22 Deposition Author(s): Chen, Z. , Tian, Z.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lysine-specific demethylase REF6 | A | 140 | Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVEEKEEEEEEEENEEEECAAYQCNMEGCTMSFSSEKQLMLHKRNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGARPYVCAEPDCGQTFRFVSDFSRHKRKTGHSVKKTNKR |
Method: X-RAY DIFFRACTION