Crystal structure of na+ bound peptidyl-trna hydrolase from acinetobacter baumannii at 2.19 a resolution
PDB DOI: 10.2210/pdb6a31/pdb
Classification: HYDROLASE Organism(s): Acinetobacter Baumannii (Strain Atcc 19606 / Dsm 30007 / Cip 70.34 / Jcm 6841 / Nbrc 109757 / Ncimb 12457 / Nctc 12156 / 81)
Deposited: 2018-06-14 Deposition Author(s): Bairagya, H.R. , Sharma, P. , Sharma, S. , Singh, P.K. , Singh, T.P.
Crystal structure of na+ bound peptidyl-trna hydrolase from acinetobacter baumannii at 2.19 a resolution
Bairagya, H.R. , Sharma, P. , Sharma, S. , Singh, P.K. , Singh, T.P.
Primary Citation of Related Structures: 6A31
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-tRNA hydrolase | A | 193 | Acinetobacter Baumannii (Strain Atcc 19606 / Dsm 30007 / Cip 70.34 / Jcm 6841 / Nbrc 109757 / Ncimb 12457 / Nctc 12156 / 81) | MSNISLIVGLGNPGSEYAQTRHNAGFWFVEQLADKYGITLKNDPKFHGISGRGNIEGHDVRLLLPMTYMNRSGQSVVPFSKFYQIAPEAILIAHDELDMNPGVIRLKTGGGHGGHNGLRDIVPHIGPNFHRLRIGIGHPGSKERVSGHVLGKAPSNEQSLMDGAIDHALSKVKLLVQGQVPQAMNQINAYKPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-06-14 Deposition Author(s): Bairagya, H.R. , Sharma, P. , Sharma, S. , Singh, P.K. , Singh, T.P.