Crystal structure of the human coronavirus mers hr1 motif in complex with pan-covs inhibitor ek1
PDB DOI: 10.2210/pdb5zvk/pdb
Classification: VIRAL PROTEIN/INHIBITOR Organism(s): Middle East Respiratory Syndrome-Related Coronavirus , Synthetic Construct
Deposited: 2018-05-11 Deposition Author(s): Wilson, I.A. , Yan, L. , Yang, B.
Method: X-RAY DIFFRACTION Resolution: 3.31 Å
Crystal structure of the human coronavirus mers hr1 motif in complex with pan-covs inhibitor ek1
Wilson, I.A. , Yan, L. , Yang, B.
Primary Citation of Related Structures: 5ZVK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| pan-CoV inhibitory peptide EK1 | A | 44 | Middle East Respiratory Syndrome-Related Coronavirus , Synthetic Construct | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
| pan-CoV inhibitory peptide EK1 | B | 44 | Middle East Respiratory Syndrome-Related Coronavirus , Synthetic Construct | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
| pan-CoV inhibitory peptide EK1 | C | 44 | Middle East Respiratory Syndrome-Related Coronavirus , Synthetic Construct | SGGRGGSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-05-11 Deposition Author(s): Wilson, I.A. , Yan, L. , Yang, B.