Crystal structure of aprt from y. pseudotuberculosis with bound adenine (c2 space group).
PDB DOI: 10.2210/pdb5zoc/pdb
Classification: TRANSFERASE Organism(s): Yersinia Pseudotuberculosis Ip 32953
Deposited: 2018-04-12 Deposition Author(s): Pavithra, G.C. , Ramagopal, U.A.
Crystal structure of aprt from y. pseudotuberculosis with bound adenine (c2 space group).
Pavithra, G.C. , Ramagopal, U.A.
Primary Citation of Related Structures: 5ZOC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Adenine phosphoribosyltransferase | A | 187 | Yersinia Pseudotuberculosis Ip 32953 | MTVSASKTAQQLKYIKDSIKTIPDYPKAGILFRDVTSLLENPKAYSASIELLSEHYSESGVTKVVGTEARGFLFGAPVALALGVGFVPVRKPGKLPRETISESYELEYGTDTLEIHTDSIQPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVVHAAFIINLPELGGEARLTQQGIHCYSLVSFDGH |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-04-12 Deposition Author(s): Pavithra, G.C. , Ramagopal, U.A.