Structure of abdb/exd complex bound to a 'magenta14' dna sequence
PDB DOI: 10.2210/pdb5zjr/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-03-22 Deposition Author(s): Baburajendran, N. , Honig, B. , Kaczynska, A. , Mann, R. , Palmer, A.G. , Shapiro, L. , Zeiske, T.
Structure of abdb/exd complex bound to a 'magenta14' dna sequence
Baburajendran, N. , Honig, B. , Kaczynska, A. , Mann, R. , Palmer, A.G. , Shapiro, L. , Zeiske, T.
Primary Citation of Related Structures: 5ZJR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Homeobox protein abdominal-B | A | 84 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | VGPCTPNPGLHEWTGQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKKNSQRQANQ |
Homeobox protein extradenticle | B | 74 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLY |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-03-22 Deposition Author(s): Baburajendran, N. , Honig, B. , Kaczynska, A. , Mann, R. , Palmer, A.G. , Shapiro, L. , Zeiske, T.