Crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution
PDB DOI: 10.2210/pdb5zcy/pdb
Classification: TRANSLATION Organism(s): Pyrococcus Horikoshii (Strain Atcc 700860 / Dsm 12428 / Jcm 9974 / Nbrc 100139 / Ot-3)
Deposited: 2018-02-22 Deposition Author(s): Gogoi, P. , Kanaujia, S.P.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution
Primary Citation of Related Structures: 5ZCY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein translation factor SUI1 homolog | A | 99 | Pyrococcus Horikoshii (Strain Atcc 700860 / Dsm 12428 / Jcm 9974 / Nbrc 100139 / Ot-3) | MVPRIVNPLDEMLFKEVLKEQQRIKVYIERARYGKVKTIIEGIDEKEFDLEEIAKKLKAKLACGGTAKNGRIELQGDHRDRIKKLLAELGFSEELIEVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-02-22 Deposition Author(s): Gogoi, P. , Kanaujia, S.P.