Nmr solution structure of the kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ror1)
PDB DOI: 10.2210/pdb5z55/pdb
Classification: ONCOPROTEIN Organism(s): Homo Sapiens
Deposited: 2018-01-17 Deposition Author(s): Hu, K.F. , Ma, X.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inactive tyrosine-protein kinase transmembrane receptor ROR1 | A | 85 | Homo Sapiens | GSKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSK |
Method: SOLUTION NMR