Crystal structure of copper-bound tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 2 h at 298 k
PDB DOI: 10.2210/pdb5z0h/pdb
Classification: OXIDOREDUCTASE/METAL BINDING PROTEIN Organism(s): Streptomyces Castaneoglobisporus
Deposited: 2017-12-19 Deposition Author(s): Matoba, Y. , Sugiyama, M.
Crystal structure of copper-bound tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the hydroxylamine-containing solution for 2 h at 298 k
Primary Citation of Related Structures: 5Z0H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosinase | A | 281 | Streptomyces Castaneoglobisporus | MTVRKNQATLTADEKRRFVAAVLELKRSGRYDEFVRTHNEFIMSDTDSGERTGHRSPSFLPWHRRFLLDFEQALQSVDSSVTLPYWDWSADRTVRASLWAPDFLGGTGRSTDGRVMDGPFAASTGNWPINVRVDSRTYLRRSLGGSVAELPTRAEVESVLAISAYDLPPYNSASEGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYVDKLWAEWQRRHPDSAYVPTGGTPDVVDLNETMKPWNTVRPADLLDHTAYYTFDALEHHHHHH |
| MelC | B | 134 | Streptomyces Castaneoglobisporus | MPEITRRRALTAAAAVAATASAAVTLAAPAASAAGHHEPAAPESFDEVYKGRRIQGRPAGGGAHHHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPFPANLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-12-19 Deposition Author(s): Matoba, Y. , Sugiyama, M.