Solution structure of lysm domain from a chitinase derived from volvox carteri
PDB DOI: 10.2210/pdb5yzk/pdb
Classification: HYDROLASE Organism(s): Volvox Carteri F. Nagariensis
Deposited: 2017-12-15 Deposition Author(s): Fukamizo, T. , Kitaoku, Y. , Nishimura, S. , Ohnuma, T.
Solution structure of lysm domain from a chitinase derived from volvox carteri
Fukamizo, T. , Kitaoku, Y. , Nishimura, S. , Ohnuma, T.
Primary Citation of Related Structures: 5YZK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Chitinase, lysozyme | A | 49 | Volvox Carteri F. Nagariensis | MGCTYTIQPGDTFWAIAQRRGTTVDVIQSLNPGVNPARLQVGQVINVPC |
Method: SOLUTION NMR
Deposited Date: 2017-12-15 Deposition Author(s): Fukamizo, T. , Kitaoku, Y. , Nishimura, S. , Ohnuma, T.