Crystal structure of sdg8 cw domain in complex with h3k4me1 peptide
PDB DOI: 10.2210/pdb5yvx/pdb
Classification: TRANSFERASE Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2017-11-27 Deposition Author(s): Huang, Y. , Liu, Y.
Method: X-RAY DIFFRACTION Resolution: 1.591 Å
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase ASHH2 | A | 60 | Arabidopsis Thaliana , Synthetic Construct | ESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINAELGI |
| H3K4me1 | C | 9 | Arabidopsis Thaliana , Synthetic Construct | ARTKQTARK |
Method: X-RAY DIFFRACTION