Crystal structure of yb1 cold-shock domain in complex with ucuucu
PDB DOI: 10.2210/pdb5yts/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-11-20 Deposition Author(s): Huang, Y. , Yang, X.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nuclease-sensitive element-binding protein 1 | A | 83 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGG |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA (5'-R(P*CP*UP*UP*C)-3') | b | 6 | NA | UCUUCU |
Method: X-RAY DIFFRACTION