Structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems
PDB DOI: 10.2210/pdb5ykw/pdb
Classification: TRANSFERASE Organism(s): Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Saccharomyces Cerevisiae S288C
Deposited: 2017-10-16 Deposition Author(s): Bao, R. , He, L.H. , Li, C.C. , Li, T. , Liu, L. , Peng, C.T. , Song, Y.J. , Yang, J. , Yang, M.J. , Zhao, C. , Zhao, N.L. , Zhu, Y.B.
Method: X-RAY DIFFRACTION Resolution: 2.08 Å
Structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems
Bao, R. , He, L.H. , Li, C.C. , Li, T. , Liu, L. , Peng, C.T. , Song, Y.J. , Yang, J. , Yang, M.J. , Zhao, C. , Zhao, N.L. , Zhu, Y.B.
Primary Citation of Related Structures: 5YKW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin-3, mitochondrial | A | 106 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Saccharomyces Cerevisiae S288C | SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPSKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL |
| peptide THR-PRO-VAL-CYS-THR-THR-GLU-VAL | B | 8 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Saccharomyces Cerevisiae S288C | TPVCTTEV |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-10-16 Deposition Author(s): Bao, R. , He, L.H. , Li, C.C. , Li, T. , Liu, L. , Peng, C.T. , Song, Y.J. , Yang, J. , Yang, M.J. , Zhao, C. , Zhao, N.L. , Zhu, Y.B.