Solution structure of the lekti domain 4
PDB DOI: 10.2210/pdb5yhn/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Homo Sapiens
Deposited: 2017-09-29 Deposition Author(s): Mok, Y.K. , Ramesh, K.
Solution structure of the lekti domain 4
Primary Citation of Related Structures: 5YHN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cDNA FLJ60407, highly similar to Serine protease inhibitor Kazal-type 5 | A | 69 | Homo Sapiens | AEKDFCKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFKRRFSEENSKTDQNLGKAEEKTK |
Method: SOLUTION NMR
Deposited Date: 2017-09-29 Deposition Author(s): Mok, Y.K. , Ramesh, K.