5Y7W
Crystal structure of the nco-a1 pas-b domain with yl-2
PDB DOI: 10.2210/pdb5y7w/pdb
Classification: TRANSCRIPTION/INIHIBITOR Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-08-18 Deposition Author(s): Bae, J.H. , Lee, J.H. , Lee, Y.J. , Lim, H.S. , Song, J.Y. , Yoon, H.S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.25 Å
Crystal structure of the nco-a1 pas-b domain with yl-2
Bae, J.H. , Lee, J.H. , Lee, Y.J. , Lim, H.S. , Song, J.Y. , Yoon, H.S.
Primary Citation of Related Structures: 5Y7W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear receptor coactivator 1 | A | 127 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DIFEAQKIEWHEGAHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDRE |
| Nuclear receptor coactivator 1 | B | 127 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DIFEAQKIEWHEGAHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDRE |
| YL-2 peptide | C | 16 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LLPPTEQDLLKLALYX |
| YL-2 peptide | D | 16 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LLPPTEQDLLKLALYX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-08-18 Deposition Author(s): Bae, J.H. , Lee, J.H. , Lee, Y.J. , Lim, H.S. , Song, J.Y. , Yoon, H.S.