Crystal structure of al1 phd finger bound to h3k4me3
PDB DOI: 10.2210/pdb5y20/pdb
Classification: TRANSCRIPTION Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2017-07-22 Deposition Author(s): Li, H. , Zhang, B. , Zhao, S.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHD finger protein ALFIN-LIKE 1 | A | 52 | Arabidopsis Thaliana , Synthetic Construct | DTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSCCT |
| PEPTIDE FROM HISTONE H3 | P | 7 | Arabidopsis Thaliana , Synthetic Construct | ARTKQTA |
Method: X-RAY DIFFRACTION