Crystal structure of native ribt from bacillus subtilis
PDB DOI: 10.2210/pdb5xxs/pdb
Classification: TRANSFERASE Organism(s): Bacillus Subtilis (Strain 168)
Deposited: 2017-07-04 Deposition Author(s): Karthikeyan, S. , Srivastava, R.
Crystal structure of native ribt from bacillus subtilis
Karthikeyan, S. , Srivastava, R.
Primary Citation of Related Structures: 5XXS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein RibT | A | 132 | Bacillus Subtilis (Strain 168) | MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTDRQLFLWKEDEDIVGAIGVEKKDSEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQVLVPNELTQSFFERCQGQQDQDISYNNLEHHHHHH |
| Protein RibT | B | 132 | Bacillus Subtilis (Strain 168) | MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTDRQLFLWKEDEDIVGAIGVEKKDSEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQVLVPNELTQSFFERCQGQQDQDISYNNLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-07-04 Deposition Author(s): Karthikeyan, S. , Srivastava, R.