5XO2
Crystal structure of human paired immunoglobulin-like type 2 receptor alpha with synthesized glycopeptide ii
PDB DOI: 10.2210/pdb5xo2/pdb
Classification: IMMUNE SYSTEM Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-05-25 Deposition Author(s): Anada, M. , Arase, H. , Furukawa, A. , Hashimoto, S. , Hatori, N. , Ishizuka, M. , Kakita, K. , Kuroki, K. , Maeda, N. , Maenaka, K. , Matsunaga, S. , Nambu, H. , Nomura, T. , Ohsaka, F. , Ose, T. , Saitoh, T. , Sakamoto, J. , Yamada, T.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.201 Å
Crystal structure of human paired immunoglobulin-like type 2 receptor alpha with synthesized glycopeptide ii
Anada, M. , Arase, H. , Furukawa, A. , Hashimoto, S. , Hatori, N. , Ishizuka, M. , Kakita, K. , Kuroki, K. , Maeda, N. , Maenaka, K. , Matsunaga, S. , Nambu, H. , Nomura, T. , Ohsaka, F. , Ose, T. , Saitoh, T. , Sakamoto, J. , Yamada, T.
Primary Citation of Related Structures: 5XO2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Paired immunoglobulin-like type 2 receptor alpha | A | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSIT |
| Paired immunoglobulin-like type 2 receptor alpha | B | 120 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSIT |
| Peptide from Envelope glycoprotein B | X | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPATPAP |
| Peptide from Envelope glycoprotein B | Y | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPATPAP |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-25 Deposition Author(s): Anada, M. , Arase, H. , Furukawa, A. , Hashimoto, S. , Hatori, N. , Ishizuka, M. , Kakita, K. , Kuroki, K. , Maeda, N. , Maenaka, K. , Matsunaga, S. , Nambu, H. , Nomura, T. , Ohsaka, F. , Ose, T. , Saitoh, T. , Sakamoto, J. , Yamada, T.