Crystal structure of yeats2 yeats bound to h3k27ac peptide
PDB DOI: 10.2210/pdb5xnv/pdb
Classification: PROTEIN BINDING/PEPTIDE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2017-05-24 Deposition Author(s): Guan, H.P. , Li, H.T. , Zhao, D.
Crystal structure of yeats2 yeats bound to h3k27ac peptide
Guan, H.P. , Li, H.T. , Zhao, D.
Primary Citation of Related Structures: 5XNV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
YEATS domain-containing protein 2 | A | 133 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | STSRLFVKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQVHFKDSQNKRIDIIHNLKLDRTYTGLQTLGAETVVDVELHRH |
ALA-ALA-ARG-ALY-SER-ALA-PRO-ALA | B | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AARKSAPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-24 Deposition Author(s): Guan, H.P. , Li, H.T. , Zhao, D.