Crystal structure of rv0289/espg3 from the esx-3 type vii secretion system of m. tuberculosis
PDB DOI: 10.2210/pdb5xkl/pdb
Classification: CHAPERONE Organism(s): Mycobacterium Tuberculosis H37Rv
Deposited: 2017-05-08 Deposition Author(s): Arulandu, A. , Ojha, A. , Raina, R.
Crystal structure of rv0289/espg3 from the esx-3 type vii secretion system of m. tuberculosis
Arulandu, A. , Ojha, A. , Raina, R.
Primary Citation of Related Structures: 5XKL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ESX-3 secretion-associated protein EspG3 | A | 296 | Mycobacterium Tuberculosis H37Rv | SMDATPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQRDELTRMGLLSPQGVINPAVADWIKVVCFPDRWLDLRYVGPASADGACELLRGIVALRTGTGKTSNKTGNGVVALRNAQLVTFTAMDIDDPRALVPILGVGLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVVESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDGEWVSTFSPGTPFAIAVAIQTLTACLPDGQWFPGQRVSRDFSTQSS |
Method: X-RAY DIFFRACTION
Deposited Date: 2017-05-08 Deposition Author(s): Arulandu, A. , Ojha, A. , Raina, R.