Nmr solution structure of the aromatic mutant h43w h67f cytochrome b5
PDB DOI: 10.2210/pdb5xe4/pdb
Classification: ELECTRON TRANSPORT Organism(s): Rattus Norvegicus
Deposited: 2017-03-31 Deposition Author(s): Balakrishnan, S. , Sarma, S.P.
Nmr solution structure of the aromatic mutant h43w h67f cytochrome b5
Balakrishnan, S. , Sarma, S.P.
Primary Citation of Related Structures: 5XE4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytochrome b5 | A | 98 | Rattus Norvegicus | AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEWPGGEEVLREQAGGDATENFEDVGFSTDARELSKKYIIGELHPDDRSKIAKPSETL |
Method: SOLUTION NMR
Deposited Date: 2017-03-31 Deposition Author(s): Balakrishnan, S. , Sarma, S.P.