Solution structure of heterodimeric coiled-coil domain of drosophila gabab receptor 1 and 2
PDB DOI: 10.2210/pdb5x9x/pdb
Classification: SIGNALING PROTEIN Organism(s): Murine Hepatitis Virus
Deposited: 2017-03-10 Deposition Author(s): Liu, J. , Liu, X. , Zhang, C.X. , Zhang, S.
Solution structure of heterodimeric coiled-coil domain of drosophila gabab receptor 1 and 2
Liu, J. , Liu, X. , Zhang, C.X. , Zhang, S.
Primary Citation of Related Structures: 5X9X
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Metabotropic GABA-B receptor subtype 1 | A | 44 | Murine Hepatitis Virus | MDSKEDEERYQKLVTENEQLQRLITQKEEKIRVLRQRLVERGDA |
Metabotropic GABA-B receptor subtype 2 | B | 45 | Murine Hepatitis Virus | GPLGSSVSELEQRLRDVKNTNSRFRKALMEKENELQALIRKLGPE |
Method: SOLUTION NMR
Deposited Date: 2017-03-10 Deposition Author(s): Liu, J. , Liu, X. , Zhang, C.X. , Zhang, S.