Crystal structure of taf3 phd finger bound to h3k4me3
PDB DOI: 10.2210/pdb5wxh/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-01-07 Deposition Author(s): Huang, J. , Li, H. , Zhao, S.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription initiation factor TFIID subunit 3 | A | 63 | Homo Sapiens , Synthetic Construct | SMYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANK |
Transcription initiation factor TFIID subunit 3 | C | 63 | Homo Sapiens , Synthetic Construct | SMYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANK |
Histone H3K4me3 | D | 7 | Homo Sapiens , Synthetic Construct | ARTKQTA |
Histone H3K4me3 | P | 7 | Homo Sapiens , Synthetic Construct | ARTKQTA |
Method: X-RAY DIFFRACTION