Structure of taf phd finger domain binds to h3(1-15)k4ac
PDB DOI: 10.2210/pdb5wxg/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2017-01-07 Deposition Author(s): Li, H. , Zhao, S.
Method: X-RAY DIFFRACTION Resolution: 1.703 Å
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor TFIID subunit 3 | A | 63 | Homo Sapiens , Synthetic Construct | SMYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANK |
| Histone H3K4ac | P | 7 | Homo Sapiens , Synthetic Construct | ARTKQTA |
Method: X-RAY DIFFRACTION