The crystal structure of cren7 mutant l28v in complex with dsdna
PDB DOI: 10.2210/pdb5wvy/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) , Synthetic Construct
Deposited: 2016-12-29 Deposition Author(s): Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.
The crystal structure of cren7 mutant l28v in complex with dsdna
Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.
Primary Citation of Related Structures: 5WVY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromatin protein Cren7 | A | 60 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWAVAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
| Chromatin protein Cren7 | B | 60 | Sulfolobus Solfataricus (Strain Atcc 35092 / Dsm 1617 / Jcm 11322 / P2) , Synthetic Construct | MSSGKKPVKVKTPAGKEAELVPEKVWAVAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI |
Method: X-RAY DIFFRACTION
Deposited Date: 2016-12-29 Deposition Author(s): Chen, Y.Y. , Dong, Y.H. , Gong, Y. , Huang, L. , Wang, L. , Zhang, Z.F. , Zhao, M.H.