Solution nmr structure of cyclotide mcoti-i
PDB DOI: 10.2210/pdb5wov/pdb
Classification: DE NOVO PROTEIN Organism(s): N.A.
Deposited: 2017-08-03 Deposition Author(s): Kwon, S. , Schroeder, C.I.
Solution nmr structure of cyclotide mcoti-i
Primary Citation of Related Structures: 5WOV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Two inhibitor peptide topologies 2 | A | 34 | N.A. | GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSD |
Method: SOLUTION NMR
Deposited Date: 2017-08-03 Deposition Author(s): Kwon, S. , Schroeder, C.I.